PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097410001
Common NameGSBRNA2T00097410001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 365aa    MW: 41500.1 Da    PI: 6.9868
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097410001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.3e-37102161261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny++sqPr+fC++C+ryWt GG++r vPvG+grrknk +
  GSBRNA2T00097410001 102 PDKILPCPRCNSSDTKFCYYNNYNVSQPRHFCRSCQRYWTSGGSMRTVPVGSGRRKNKGW 161
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3098159IPR003851Zinc finger, Dof-type
PfamPF027013.3E-31104159IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.351106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSELRDTPVK LFGWTITSSL SSLVLVLKIK LNIFFFSVYH FETSFMMLMS NQSATDDIEQ  60
DSTSLQRSSD LTEESKETSE NSEITTTTTT SEEKTTDDLK KPDKILPCPR CNSSDTKFCY  120
YNNYNVSQPR HFCRSCQRYW TSGGSMRTVP VGSGRRKNKG WVSSDNYMHI KSEDTNSYNS  180
SPAKILSFDS SGEESLVTEN DKNQSSDSVS KKFNKFQRFL PPQVTSSVSP PWPYQYPPNP  240
AFYQIPVYWG CTVPFWSTLQ TCTCLGKRTR DEASHVSVGE NEDTSVRARL DSQSRSNTDE  300
ANVATKNRVF YPLPMEREKT HQFSLFVNGS ETKSGNNRFV PETYLNLQAN PEAMSRSMNF  360
RESM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065356e-88AC006535.7 Genomic sequence for Arabidopsis thaliana BAC T24P13 from chromosome I, complete sequence.
GenBankCP0026846e-88CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013740119.10.0PREDICTED: dof zinc finger protein DOF1.3-like
SwissprotQ9LQX41e-161DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A078II900.0A0A078II90_BRANA; BnaC05g50980D protein
STRINGBra024683.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.11e-133Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]